SCOPe 2.01: Domain d2bp3a1: 2bp3 A:1863-1954

Lineage for d2bp3a1 (2bp3 A:1863-1954)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin a [141023] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141024] (4 PDB entries)
   Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328

8. Domain d2bp3a1: 2bp3 A:1863-1954 [128919]
   Other proteins in same PDB: d2bp3b_
   17th repeat
   complexed with gol

Details for d2bp3a1

PDB Entry: 2bp3, 2.32 Å

PDB Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex

PDB Compounds: (A:) Filamin A

SCOPe Domain Sequences for d2bp3a1:

Sequence, based on SEQRES records:

>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
vncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsv
sylpvlpgdysilvkyneqhvpgspftarvtg

Sequence, based on observed residues (ATOM records):

>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
vnchvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvs
ylpvlpgdysilvkyneqhvpgspftarvtg

Timeline for d2bp3a1:

• d2bp3a1 first appeared in SCOP 1.73
  
• d2bp3a1 appears in SCOP 1.75
  
• d2bp3a1 appears in SCOPe 2.02
  
• d2bp3a1 appears in the current release, SCOPe 2.08