SCOPe 2.07: Domain d2bozl_: 2boz L:

Lineage for d2bozl_ (2boz L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2bozl_: 2boz L: [128918]
   Other proteins in same PDB: d2bozh1, d2bozh2, d2bozm1
   automated match to d1aigl_
   complexed with bcl, bph, d10, fe, lda, po4, spn, u10; mutant

Details for d2bozl_

PDB Entry: 2boz, 2.4 Å

PDB Description: Photosynthetic Reaction Center Mutant With Gly M203 Replaced With Leu

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2bozl_:

Sequence; same for both SEQRES and ATOM records:

>d2bozl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2bozl_:

• d2bozl_ first appeared in SCOP 1.73, called d2bozl1
  
• d2bozl_ appears in SCOPe 2.06
  
• d2bozl_ appears in the current release, SCOPe 2.08