![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Coagulation factor Xa, protease domain [50574] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50575] (58 PDB entries) |
![]() | Domain d2boka1: 2bok A:16-244 [128916] Other proteins in same PDB: d2bokl1 automatically matched to d1c5md_ complexed with 784, na; mutant |
PDB Entry: 2bok (more details), 1.64 Å
SCOP Domain Sequences for d2boka1:
Sequence, based on SEQRES records: (download)
>d2boka1 b.47.1.2 (A:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
>d2boka1 b.47.1.2 (A:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgavhev evvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlmtqktgivsgfg rthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqedacqgdsggphvt rfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d2boka1: