Lineage for d2bodx1 (2bod X:2-286)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689535Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) (S)
  5. 689536Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 protein domains)
    Pfam PF01341
  6. 689567Protein Cellulase E2 [51991] (1 species)
  7. 689568Species Thermomonospora fusca, strain yx [TaxId:269800] [51992] (2 PDB entries)
  8. 689569Domain d2bodx1: 2bod X:2-286 [128909]
    automatically matched to d1tml__
    complexed with bgc, mgl, sgc

Details for d2bodx1

PDB Entry: 2bod (more details), 1.5 Å

PDB Description: catalytic domain of endo-1,4-glucanase cel6a from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside
PDB Compounds: (X:) endoglucanase e-2

SCOP Domain Sequences for d2bodx1:

Sequence, based on SEQRES records: (download)

>d2bodx1 c.6.1.1 (X:2-286) Cellulase E2 {Thermomonospora fusca, strain yx [TaxId: 2021]}
dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsaa
qaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlisl
msscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisnsa
hgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraigt
psttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

Sequence, based on observed residues (ATOM records): (download)

>d2bodx1 c.6.1.1 (X:2-286) Cellulase E2 {Thermomonospora fusca, strain yx [TaxId: 2021]}
dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsaa
qaagkipilvvynapgrdcgapshsayrswidefaaglknrpayiivepdlislmsscmq
hvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisnsahgiatn
tsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraigtpsttnt
gdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

SCOP Domain Coordinates for d2bodx1:

Click to download the PDB-style file with coordinates for d2bodx1.
(The format of our PDB-style files is described here.)

Timeline for d2bodx1: