Lineage for d2bodx_ (2bod X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097537Protein Cellulase E2 [51991] (1 species)
  7. 2097538Species Thermobifida fusca YX [TaxId:269800] [51992] (5 PDB entries)
  8. 2097541Domain d2bodx_: 2bod X: [128909]
    automated match to d1tml__

Details for d2bodx_

PDB Entry: 2bod (more details), 1.5 Å

PDB Description: catalytic domain of endo-1,4-glucanase cel6a from thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside
PDB Compounds: (X:) endoglucanase e-2

SCOPe Domain Sequences for d2bodx_:

Sequence, based on SEQRES records: (download)

>d2bodx_ c.6.1.1 (X:) Cellulase E2 {Thermobifida fusca YX [TaxId: 269800]}
dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsaa
qaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlisl
msscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisnsa
hgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraigt
psttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

Sequence, based on observed residues (ATOM records): (download)

>d2bodx_ c.6.1.1 (X:) Cellulase E2 {Thermobifida fusca YX [TaxId: 269800]}
dspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsaa
qaagkipilvvynapgrdcgapshsayrswidefaaglknrpayiivepdlislmsscmq
hvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisnsahgiatn
tsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraigtpsttnt
gdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

SCOPe Domain Coordinates for d2bodx_:

Click to download the PDB-style file with coordinates for d2bodx_.
(The format of our PDB-style files is described here.)

Timeline for d2bodx_: