SCOPe 2.01: Domain d2boab2: 2boa B:4-99

Lineage for d2boab2 (2boa B:4-99)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries)
   procarboxypeptidase A2

8. Domain d2boab2: 2boa B:4-99 [128906]
   Other proteins in same PDB: d2boaa1, d2boab1
   automatically matched to 2BOA A:4-99
   complexed with gol, nag, zn

Details for d2boab2

PDB Entry: 2boa, 2.2 Å

PDB Description: human procarboxypeptidase a4.

PDB Compounds: (B:) carboxypeptidase a4

SCOPe Domain Sequences for d2boab2:

Sequence; same for both SEQRES and ATOM records:

>d2boab2 d.58.3.1 (B:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
sflrsqgleyavtiedlqalldneddemqhnegq

Timeline for d2boab2:

• d2boab2 first appeared in SCOP 1.73
  
• d2boab2 appears in SCOP 1.75
  
• d2boab2 appears in SCOPe 2.02
  
• d2boab2 appears in the current release, SCOPe 2.08