Lineage for d2boab2 (2boa B:4-99)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861368Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) (S)
  5. 861369Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 861370Protein Procarboxypeptidase A [54899] (4 species)
  7. 861375Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries)
    procarboxypeptidase A2
  8. 861378Domain d2boab2: 2boa B:4-99 [128906]
    Other proteins in same PDB: d2boaa1, d2boab1
    automatically matched to 2BOA A:4-99
    complexed with gol, nag, zn

Details for d2boab2

PDB Entry: 2boa (more details), 2.2 Å

PDB Description: human procarboxypeptidase a4.
PDB Compounds: (B:) carboxypeptidase a4

SCOP Domain Sequences for d2boab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2boab2 d.58.3.1 (B:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
sflrsqgleyavtiedlqalldneddemqhnegq

SCOP Domain Coordinates for d2boab2:

Click to download the PDB-style file with coordinates for d2boab2.
(The format of our PDB-style files is described here.)

Timeline for d2boab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2boab1