![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) ![]() |
![]() | Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
![]() | Protein Procarboxypeptidase A [54899] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries) procarboxypeptidase A2 |
![]() | Domain d2boab2: 2boa B:4-99 [128906] Other proteins in same PDB: d2boaa1, d2boab1 automated match to d2boaa2 complexed with gol, nag, zn |
PDB Entry: 2boa (more details), 2.2 Å
SCOPe Domain Sequences for d2boab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2boab2 d.58.3.1 (B:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk sflrsqgleyavtiedlqalldneddemqhnegq
Timeline for d2boab2: