SCOPe 2.07: Domain d2boab1: 2boa B:1001-1309

Lineage for d2boab1 (2boa B:1001-1309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries)

8. Domain d2boab1: 2boa B:1001-1309 [128905]
   Other proteins in same PDB: d2boaa2, d2boab2
   automated match to d2boaa1
   complexed with gol, nag, zn

Details for d2boab1

PDB Entry: 2boa, 2.2 Å

PDB Description: human procarboxypeptidase a4.

PDB Compounds: (B:) carboxypeptidase a4

SCOPe Domain Sequences for d2boab1:

Sequence; same for both SEQRES and ATOM records:

>d2boab1 c.56.5.1 (B:1001-1309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
erssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrr
pavwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvyt
qtqnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksv
vdfiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyq
vgptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglkt
imehvrdnly

Timeline for d2boab1:

• d2boab1 first appeared in SCOP 1.73
  
• d2boab1 appears in SCOPe 2.06
  
• d2boab1 appears in the current release, SCOPe 2.08