SCOPe 2.06: Domain d2boaa2: 2boa A:4-99

Lineage for d2boaa2 (2boa A:4-99)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries)
   procarboxypeptidase A2

8. Domain d2boaa2: 2boa A:4-99 [128904]
   Other proteins in same PDB: d2boaa1, d2boab1
   Procarboxypeptidase A4
   complexed with gol, nag, zn

Details for d2boaa2

PDB Entry: 2boa, 2.2 Å

PDB Description: human procarboxypeptidase a4.

PDB Compounds: (A:) carboxypeptidase a4

SCOPe Domain Sequences for d2boaa2:

Sequence; same for both SEQRES and ATOM records:

>d2boaa2 d.58.3.1 (A:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
sflrsqgleyavtiedlqalldneddemqhnegq

Timeline for d2boaa2:

• d2boaa2 first appeared in SCOP 1.73
  
• d2boaa2 appears in SCOPe 2.05
  
• d2boaa2 appears in SCOPe 2.07
  
• d2boaa2 appears in the current release, SCOPe 2.08