Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) |
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
Protein Procarboxypeptidase A [54899] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries) procarboxypeptidase A2 |
Domain d2boaa2: 2boa A:4-99 [128904] Other proteins in same PDB: d2boaa1, d2boab1 Procarboxypeptidase A4 complexed with gol, nag, zn |
PDB Entry: 2boa (more details), 2.2 Å
SCOPe Domain Sequences for d2boaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2boaa2 d.58.3.1 (A:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk sflrsqgleyavtiedlqalldneddemqhnegq
Timeline for d2boaa2: