Lineage for d2boaa2 (2boa A:4-99)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949661Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2949662Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 2949663Protein Procarboxypeptidase A [54899] (4 species)
  7. 2949668Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries)
    procarboxypeptidase A2
  8. 2949670Domain d2boaa2: 2boa A:4-99 [128904]
    Other proteins in same PDB: d2boaa1, d2boab1
    Procarboxypeptidase A4
    complexed with gol, nag, zn

Details for d2boaa2

PDB Entry: 2boa (more details), 2.2 Å

PDB Description: human procarboxypeptidase a4.
PDB Compounds: (A:) carboxypeptidase a4

SCOPe Domain Sequences for d2boaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2boaa2 d.58.3.1 (A:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
rekffgdqvlrinvrngdeisklsqlvnsnnlklnfwkspssfnrpvdvlvpsvslqafk
sflrsqgleyavtiedlqalldneddemqhnegq

SCOPe Domain Coordinates for d2boaa2:

Click to download the PDB-style file with coordinates for d2boaa2.
(The format of our PDB-style files is described here.)

Timeline for d2boaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2boaa1