Lineage for d2boaa1 (2boa A:1001-1309)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142306Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2142307Protein Carboxypeptidase A [53189] (4 species)
  7. 2142361Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries)
  8. 2142369Domain d2boaa1: 2boa A:1001-1309 [128903]
    Other proteins in same PDB: d2boaa2, d2boab2
    Procarboxypeptidase A4
    complexed with gol, nag, zn

Details for d2boaa1

PDB Entry: 2boa (more details), 2.2 Å

PDB Description: human procarboxypeptidase a4.
PDB Compounds: (A:) carboxypeptidase a4

SCOPe Domain Sequences for d2boaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2boaa1 c.56.5.1 (A:1001-1309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
erssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrr
pavwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvyt
qtqnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksv
vdfiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyq
vgptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglkt
imehvrdnly

SCOPe Domain Coordinates for d2boaa1:

Click to download the PDB-style file with coordinates for d2boaa1.
(The format of our PDB-style files is described here.)

Timeline for d2boaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2boaa2