Lineage for d2bo9d2 (2bo9 D:99-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935855Family d.17.1.5: Latexin-like [142991] (2 proteins)
    Pfam PF06907; duplication: consits of two domains of this fold
  6. 2935856Protein Latexin [142992] (1 species)
  7. 2935857Species Human (Homo sapiens) [TaxId:9606] [142993] (2 PDB entries)
    Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217
  8. 2935863Domain d2bo9d2: 2bo9 D:99-217 [128902]
    Other proteins in same PDB: d2bo9a1, d2bo9c_
    automated match to d2bo9b2
    complexed with acn, mpd, nag, val, zn

Details for d2bo9d2

PDB Entry: 2bo9 (more details), 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.
PDB Compounds: (D:) human latexin

SCOPe Domain Sequences for d2bo9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo9d2 d.17.1.5 (D:99-217) Latexin {Human (Homo sapiens) [TaxId: 9606]}
pdeedntfyqrlksmkepleaqnipdnfgnvspemtlvlhlawvacgyiiwqnstedtwy
kmvkiqtvkqvqrnddfieldytillhniasqeiipwqmqvlwhpqygtkvkhnsrlpk

SCOPe Domain Coordinates for d2bo9d2:

Click to download the PDB-style file with coordinates for d2bo9d2.
(The format of our PDB-style files is described here.)

Timeline for d2bo9d2: