SCOPe 2.07: Domain d2bo9d1: 2bo9 D:1-98

Lineage for d2bo9d1 (2bo9 D:1-98)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.5: Latexin-like [142991] (2 proteins)
   Pfam PF06907; duplication: consits of two domains of this fold

6. Protein Latexin [142992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142993] (2 PDB entries)
   Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217

8. Domain d2bo9d1: 2bo9 D:1-98 [128901]
   Other proteins in same PDB: d2bo9a1, d2bo9c_
   automated match to d2bo9b1
   complexed with acn, mpd, nag, val, zn

Details for d2bo9d1

PDB Entry: 2bo9, 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.

PDB Compounds: (D:) human latexin

SCOPe Domain Sequences for d2bo9d1:

Sequence; same for both SEQRES and ATOM records:

>d2bo9d1 d.17.1.5 (D:1-98) Latexin {Human (Homo sapiens) [TaxId: 9606]}
meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
iiqkqvkvnctaevlypstgqetapevnftfegetgkn

Timeline for d2bo9d1:

• d2bo9d1 first appeared in SCOP 1.73
  
• d2bo9d1 appears in SCOPe 2.06
  
• d2bo9d1 appears in the current release, SCOPe 2.08