SCOP 1.73: Domain d2bo9d1: 2bo9 D:1-98

Lineage for d2bo9d1 (2bo9 D:1-98)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (5 families)
   has a additional strand at the N-terminus

5. Family d.17.1.5: Latexin-like [142991] (1 protein)
   Pfam PF06907; duplication: consits of two domains of this fold

6. Protein Latexin [142992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142993] (1 PDB entry)

8. Domain d2bo9d1: 2bo9 D:1-98 [128901]
   Other proteins in same PDB: d2bo9a1, d2bo9c1
   automatically matched to 2BO9 B:1-98
   complexed with acn, mpd, nag, val, zn

Details for d2bo9d1

PDB Entry: 2bo9, 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.

PDB Compounds: (D:) human latexin

SCOP Domain Sequences for d2bo9d1:

Sequence; same for both SEQRES and ATOM records:

>d2bo9d1 d.17.1.5 (D:1-98) Latexin {Human (Homo sapiens) [TaxId: 9606]}
meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
iiqkqvkvnctaevlypstgqetapevnftfegetgkn

Timeline for d2bo9d1:

• d2bo9d1 is new in SCOP 1.73
  
• d2bo9d1 appears in SCOP 1.75
  
• d2bo9d1 appears in the current release, SCOPe 2.08