Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.5: Latexin-like [142991] (2 proteins) Pfam PF06907; duplication: consits of two domains of this fold |
Protein Latexin [142992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142993] (2 PDB entries) Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217 |
Domain d2bo9d1: 2bo9 D:1-98 [128901] Other proteins in same PDB: d2bo9a1, d2bo9c_ automated match to d2bo9b1 complexed with acn, mpd, nag, val, zn |
PDB Entry: 2bo9 (more details), 1.6 Å
SCOPe Domain Sequences for d2bo9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bo9d1 d.17.1.5 (D:1-98) Latexin {Human (Homo sapiens) [TaxId: 9606]} meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee iiqkqvkvnctaevlypstgqetapevnftfegetgkn
Timeline for d2bo9d1:
View in 3D Domains from other chains: (mouse over for more information) d2bo9a1, d2bo9b1, d2bo9b2, d2bo9c_ |