Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins) |
Protein Carboxypeptidase A [53189] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [53192] (5 PDB entries) |
Domain d2bo9c1: 2bo9 C:4-307 [128900] Other proteins in same PDB: d2bo9b1, d2bo9b2, d2bo9d1, d2bo9d2 automatically matched to 2BO9 A:4-307 complexed with acn, mpd, nag, val, zn |
PDB Entry: 2bo9 (more details), 1.6 Å
SCOP Domain Sequences for d2bo9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bo9c1 c.56.5.1 (C:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} snnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpav wlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqtq nrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvdf iqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvgp tcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktime hvrdn
Timeline for d2bo9c1: