SCOPe 2.08: Domain d2bo9c_: 2bo9 C:

Lineage for d2bo9c_ (2bo9 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries)

8. Domain d2bo9c_: 2bo9 C: [128900]
   Other proteins in same PDB: d2bo9b1, d2bo9b2, d2bo9d1, d2bo9d2
   automated match to d2bo9a1
   complexed with acn, mpd, nag, val, zn

Details for d2bo9c_

PDB Entry: 2bo9, 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.

PDB Compounds: (C:) carboxypeptidase a4

SCOPe Domain Sequences for d2bo9c_:

Sequence; same for both SEQRES and ATOM records:

>d2bo9c_ c.56.5.1 (C:) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
ehvrdnl

Timeline for d2bo9c_:

• d2bo9c_ first appeared in SCOP 1.73, called d2bo9c1
  
• d2bo9c_ appears in SCOPe 2.07