Lineage for d2bo9b1 (2bo9 B:1-98)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855302Superfamily d.17.1: Cystatin/monellin [54403] (6 families) (S)
    has a additional strand at the N-terminus
  5. 855389Family d.17.1.5: Latexin-like [142991] (1 protein)
    Pfam PF06907; duplication: consits of two domains of this fold
  6. 855390Protein Latexin [142992] (1 species)
  7. 855391Species Human (Homo sapiens) [TaxId:9606] [142993] (1 PDB entry)
    Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217
  8. 855392Domain d2bo9b1: 2bo9 B:1-98 [128898]
    Other proteins in same PDB: d2bo9a1, d2bo9c1
    complexed with acn, mpd, nag, val, zn

Details for d2bo9b1

PDB Entry: 2bo9 (more details), 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.
PDB Compounds: (B:) human latexin

SCOP Domain Sequences for d2bo9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo9b1 d.17.1.5 (B:1-98) Latexin {Human (Homo sapiens) [TaxId: 9606]}
meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee
iiqkqvkvnctaevlypstgqetapevnftfegetgkn

SCOP Domain Coordinates for d2bo9b1:

Click to download the PDB-style file with coordinates for d2bo9b1.
(The format of our PDB-style files is described here.)

Timeline for d2bo9b1: