SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bo8h_ (2bo8 H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133869Family c.68.1.18: MGS-like [142691] (2 protein domains)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 2133889Protein automated matches [190520] (1 species)
    not a true protein
  7. 2133890Species Rhodothermus marinus [TaxId:29549] [187478] (4 PDB entries)
  8. 2133903Domain d2bo8h_: 2bo8 H: [128894]
    automated match to d2bo4a1
    complexed with cl, gdx, mn

Details for d2bo8h_

PDB Entry: 2bo8 (more details), 2.8 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
PDB Compounds: (H:) mannosylglycerate synthase

SCOPe Domain Sequences for d2bo8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo8h_ c.68.1.18 (H:) automated matches {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

SCOPe Domain Coordinates for d2bo8h_:

Click to download the PDB-style file with coordinates for d2bo8h_.
(The format of our PDB-style files is described here.)

Timeline for d2bo8h_: