Lineage for d2bo8d_ (2bo8 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506757Family c.68.1.18: MGS-like [142691] (2 proteins)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 2506777Protein automated matches [190520] (1 species)
    not a true protein
  7. 2506778Species Rhodothermus marinus [TaxId:29549] [187478] (4 PDB entries)
  8. 2506787Domain d2bo8d_: 2bo8 D: [128890]
    automated match to d2bo4a1
    complexed with cl, gdx, mn

Details for d2bo8d_

PDB Entry: 2bo8 (more details), 2.8 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
PDB Compounds: (D:) mannosylglycerate synthase

SCOPe Domain Sequences for d2bo8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo8d_ c.68.1.18 (D:) automated matches {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

SCOPe Domain Coordinates for d2bo8d_:

Click to download the PDB-style file with coordinates for d2bo8d_.
(The format of our PDB-style files is described here.)

Timeline for d2bo8d_: