Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.18: MGS-like [142691] (2 proteins) contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array |
Protein automated matches [190520] (1 species) not a true protein |
Species Rhodothermus marinus [TaxId:29549] [187478] (4 PDB entries) |
Domain d2bo6b_: 2bo6 B: [128876] automated match to d2bo4a1 complexed with dgy, mn |
PDB Entry: 2bo6 (more details), 2.45 Å
SCOPe Domain Sequences for d2bo6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bo6b_ c.68.1.18 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]} slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd yaqqylyrmlgryryqaalen
Timeline for d2bo6b_: