SCOPe 2.08: Domain d2bo6a_: 2bo6 A:

Lineage for d2bo6a_ (2bo6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.18: MGS-like [142691] (2 proteins)
   contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array

6. Protein automated matches [190520] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [187478] (4 PDB entries)

8. Domain d2bo6a_: 2bo6 A: [128875]
   automated match to d2bo4a1
   complexed with dgy, mn

Details for d2bo6a_

PDB Entry: 2bo6, 2.45 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase

PDB Compounds: (A:) mannosylglycerate synthase

SCOPe Domain Sequences for d2bo6a_:

Sequence; same for both SEQRES and ATOM records:

>d2bo6a_ c.68.1.18 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

Timeline for d2bo6a_:

• d2bo6a_ first appeared in SCOP 1.73, called d2bo6a1
  
• d2bo6a_ appears in SCOPe 2.07