SCOP 1.75: Domain d2bo4f1: 2bo4 F:2-382

Lineage for d2bo4f1 (2bo4 F:2-382)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families)

5. Family c.68.1.18: MGS-like [142691] (1 protein)
   contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array

6. Protein Mannosylglycerate synthase, MGS [142692] (1 species)

7. Species Rhodothermus marinus [TaxId:29549] [142693] (4 PDB entries)
   Uniprot Q9RFR0 2-382

8. Domain d2bo4f1: 2bo4 F:2-382 [128874]
   automatically matched to 2BO4 A:2-382
   complexed with flc

Details for d2bo4f1

PDB Entry: 2bo4, 1.95 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase

PDB Compounds: (F:) mannosylglycerate synthase

SCOP Domain Sequences for d2bo4f1:

Sequence; same for both SEQRES and ATOM records:

>d2bo4f1 c.68.1.18 (F:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

Timeline for d2bo4f1:

• d2bo4f1 first appeared in SCOP 1.73
  
• d2bo4f1 is called d2bo4f_ in SCOPe 2.01
  
• d2bo4f1 appears in the current release, SCOPe 2.08, called d2bo4f_