Lineage for d2bo4d1 (2bo4 D:2-382)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706185Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 706186Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) (S)
  5. 706627Family c.68.1.18: MGS-like [142691] (1 protein)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 706628Protein Mannosylglycerate synthase, MGS [142692] (1 species)
  7. 706629Species Rhodothermus marinus [TaxId:29549] [142693] (4 PDB entries)
  8. 706633Domain d2bo4d1: 2bo4 D:2-382 [128872]
    automatically matched to 2BO4 A:2-382
    complexed with flc

Details for d2bo4d1

PDB Entry: 2bo4 (more details), 1.95 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
PDB Compounds: (D:) mannosylglycerate synthase

SCOP Domain Sequences for d2bo4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo4d1 c.68.1.18 (D:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

SCOP Domain Coordinates for d2bo4d1:

Click to download the PDB-style file with coordinates for d2bo4d1.
(The format of our PDB-style files is described here.)

Timeline for d2bo4d1: