Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) |
Family c.68.1.18: MGS-like [142691] (1 protein) contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array |
Protein Mannosylglycerate synthase, MGS [142692] (1 species) |
Species Rhodothermus marinus [TaxId:29549] [142693] (4 PDB entries) Uniprot Q9RFR0 2-382 |
Domain d2bo4c1: 2bo4 C:2-382 [128871] automatically matched to 2BO4 A:2-382 complexed with flc |
PDB Entry: 2bo4 (more details), 1.95 Å
SCOP Domain Sequences for d2bo4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bo4c1 c.68.1.18 (C:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd yaqqylyrmlgryryqaalen
Timeline for d2bo4c1: