SCOPe 2.03: Domain d2bnzd_: 2bnz D:

Lineage for d2bnzd_ (2bnz D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
   plasmid-encoded, similar to the phage repressor family
   automatically mapped to Pfam PF07764

6. Protein automated matches [190225] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)

8. Domain d2bnzd_: 2bnz D: [128866]
   automated match to d1irqb_
   protein/DNA complex

Details for d2bnzd_

PDB Entry: 2bnz, 2.6 Å

PDB Description: structural basis for cooperative binding of ribbon-helix- helix omega repressor to inverted dna heptad repeats

PDB Compounds: (D:) orf omega

SCOPe Domain Sequences for d2bnzd_:

Sequence; same for both SEQRES and ATOM records:

>d2bnzd_ a.43.1.4 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d2bnzd_:

• d2bnzd_ first appeared in SCOP 1.73, called d2bnzd1
  
• d2bnzd_ appears in SCOPe 2.02
  
• d2bnzd_ appears in SCOPe 2.04
  
• d2bnzd_ appears in the current release, SCOPe 2.08