![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins) plasmid-encoded, similar to the phage repressor family |
![]() | Protein automated matches [190225] (1 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries) |
![]() | Domain d2bnzd_: 2bnz D: [128866] automated match to d1irqb_ protein/DNA complex |
PDB Entry: 2bnz (more details), 2.6 Å
SCOPe Domain Sequences for d2bnzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnzd_ a.43.1.4 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]} mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Timeline for d2bnzd_: