Lineage for d2bnzb1 (2bnz B:23-71)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641597Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 641598Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 641692Family a.43.1.4: Omega transcriptional repressor [100971] (1 protein)
    plasmid-encoded, similar to the phage repressor family
  6. 641693Protein Omega transcriptional repressor [69031] (1 species)
  7. 641694Species Streptococcus pyogenes [TaxId:1314] [69032] (4 PDB entries)
  8. 641702Domain d2bnzb1: 2bnz B:23-71 [128864]
    automatically matched to d1irqb_

Details for d2bnzb1

PDB Entry: 2bnz (more details), 2.6 Å

PDB Description: structural basis for cooperative binding of ribbon-helix- helix omega repressor to inverted dna heptad repeats
PDB Compounds: (B:) orf omega

SCOP Domain Sequences for d2bnzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnzb1 a.43.1.4 (B:23-71) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOP Domain Coordinates for d2bnzb1:

Click to download the PDB-style file with coordinates for d2bnzb1.
(The format of our PDB-style files is described here.)

Timeline for d2bnzb1: