Lineage for d2bnza_ (2bnz A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915404Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 915405Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 915503Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
    plasmid-encoded, similar to the phage repressor family
  6. 915508Protein automated matches [190225] (1 species)
    not a true protein
  7. 915509Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)
  8. 915514Domain d2bnza_: 2bnz A: [128863]
    automated match to d1irqb_
    protein/DNA complex

Details for d2bnza_

PDB Entry: 2bnz (more details), 2.6 Å

PDB Description: structural basis for cooperative binding of ribbon-helix- helix omega repressor to inverted dna heptad repeats
PDB Compounds: (A:) orf omega

SCOPe Domain Sequences for d2bnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnza_ a.43.1.4 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOPe Domain Coordinates for d2bnza_:

Click to download the PDB-style file with coordinates for d2bnza_.
(The format of our PDB-style files is described here.)

Timeline for d2bnza_: