Lineage for d2bnxa1 (2bnx A:133-475)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775572Family a.118.1.23: Diap1 N-terninal region-like [140830] (1 protein)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 775573Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 775574Species Mouse (Mus musculus) [TaxId:10090] [140832] (3 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 775575Domain d2bnxa1: 2bnx A:133-475 [128861]
    complexed with cl

Details for d2bnxa1

PDB Entry: 2bnx (more details), 2.4 Å

PDB Description: crystal structure of the dimeric regulatory domain of mouse diaphaneous-related formin (drf), mdia1
PDB Compounds: (A:) Diaphanous protein homolog 1

SCOP Domain Sequences for d2bnxa1:

Sequence, based on SEQRES records: (download)

>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi
vlhkngtdpdfkcrhlqidierlvdqmidktkvekseakatel

Sequence, based on observed residues (ATOM records): (download)

>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
srsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhde
keetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaak
llsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinal
itpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrld
dirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqi
vlhkngtdpdfkcrhlqidierlvktkvekseakatel

SCOP Domain Coordinates for d2bnxa1:

Click to download the PDB-style file with coordinates for d2bnxa1.
(The format of our PDB-style files is described here.)

Timeline for d2bnxa1: