Lineage for d2bnwc_ (2bnw C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491361Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1491362Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1491458Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
    plasmid-encoded, similar to the phage repressor family
    automatically mapped to Pfam PF07764
  6. 1491463Protein automated matches [190225] (1 species)
    not a true protein
  7. 1491464Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries)
  8. 1491467Domain d2bnwc_: 2bnw C: [128859]
    automated match to d1irqb_
    protein/DNA complex

Details for d2bnwc_

PDB Entry: 2bnw (more details), 2.45 Å

PDB Description: structural basis for cooperative binding of ribbon-helix-helix omega repressor to direct dna heptad repeats
PDB Compounds: (C:) orf omega

SCOPe Domain Sequences for d2bnwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnwc_ a.43.1.4 (C:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOPe Domain Coordinates for d2bnwc_:

Click to download the PDB-style file with coordinates for d2bnwc_.
(The format of our PDB-style files is described here.)

Timeline for d2bnwc_: