Class a: All alpha proteins [46456] (285 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins) plasmid-encoded, similar to the phage repressor family automatically mapped to Pfam PF07764 |
Protein automated matches [190225] (1 species) not a true protein |
Species Streptococcus pyogenes [TaxId:1314] [186986] (3 PDB entries) |
Domain d2bnwb_: 2bnw B: [128858] automated match to d1irqb_ protein/DNA complex |
PDB Entry: 2bnw (more details), 2.45 Å
SCOPe Domain Sequences for d2bnwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnwb_ a.43.1.4 (B:) automated matches {Streptococcus pyogenes [TaxId: 1314]} makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Timeline for d2bnwb_: