Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries) |
Domain d2bnsb_: 2bns B: [128856] Other proteins in same PDB: d2bnsc1, d2bnsc2 automated match to d1ystm_ complexed with bcl, bph, cl, fe2, mst, po4, u10 |
PDB Entry: 2bns (more details), 2.5 Å
SCOPe Domain Sequences for d2bnsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnsb_ f.26.1.1 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d2bnsb_: