Lineage for d2bnqa1 (2bnq A:182-276)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1759809Species Human (Homo sapiens) [TaxId:9606] [88605] (189 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1759866Domain d2bnqa1: 2bnq A:182-276 [128849]
    Other proteins in same PDB: d2bnqa2, d2bnqb_, d2bnqd1, d2bnqd2, d2bnqe1, d2bnqe2
    automatically matched to d1akja1

Details for d2bnqa1

PDB Entry: 2bnq (more details), 1.7 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2bnqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnqa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d2bnqa1:

Click to download the PDB-style file with coordinates for d2bnqa1.
(The format of our PDB-style files is described here.)

Timeline for d2bnqa1: