SCOP 1.73: Domain d2bnpb1: 2bnp B:1-302

Lineage for d2bnpb1 (2bnp B:1-302)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)

8. Domain d2bnpb1: 2bnp B:1-302 [128848]
   Other proteins in same PDB: d2bnpa1
   automatically matched to d2rcrm_
   complexed with bcl, bh1, cl, fe2, mst, po4, u10

Details for d2bnpb1

PDB Entry: 2bnp, 2.7 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, ground state

PDB Compounds: (B:) reaction centre protein m chain

SCOP Domain Sequences for d2bnpb1:

Sequence; same for both SEQRES and ATOM records:

>d2bnpb1 f.26.1.1 (B:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d2bnpb1:

• d2bnpb1 is new in SCOP 1.73
  
• d2bnpb1 appears in SCOP 1.75
  
• d2bnpb1 appears in the current release, SCOPe 2.08, called d2bnpb_