SCOPe 2.08: Domain d2bnpb_: 2bnp B:

Lineage for d2bnpb_ (2bnp B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)

8. Domain d2bnpb_: 2bnp B: [128848]
   Other proteins in same PDB: d2bnpc1, d2bnpc2
   automated match to d1ystm_
   complexed with bcl, bph, cl, fe2, mst, po4, u10

Details for d2bnpb_

PDB Entry: 2bnp, 2.7 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, ground state

PDB Compounds: (B:) reaction center protein m chain

SCOPe Domain Sequences for d2bnpb_:

Sequence; same for both SEQRES and ATOM records:

>d2bnpb_ f.26.1.1 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d2bnpb_:

• d2bnpb_ first appeared in SCOP 1.73, called d2bnpb1
  
• d2bnpb_ appears in SCOPe 2.07