SCOPe 2.08: Domain d2bnpa_: 2bnp A:

Lineage for d2bnpa_ (2bnp A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)

8. Domain d2bnpa_: 2bnp A: [128847]
   Other proteins in same PDB: d2bnpc1, d2bnpc2
   automated match to d1aigl_
   complexed with bcl, bph, cl, fe2, mst, po4, u10

Details for d2bnpa_

PDB Entry: 2bnp, 2.7 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, ground state

PDB Compounds: (A:) reaction center protein l chain

SCOPe Domain Sequences for d2bnpa_:

Sequence; same for both SEQRES and ATOM records:

>d2bnpa_ f.26.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2bnpa_:

• d2bnpa_ first appeared in SCOP 1.73, called d2bnpa1
  
• d2bnpa_ appears in SCOPe 2.07