SCOP 1.73: Domain d2bnob1: 2bno B:6-76

Lineage for d2bnob1 (2bno B:6-76)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.3: SinR domain-like [47432] (5 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries)

8. Domain d2bnob1: 2bno B:6-76 [128845]
   Other proteins in same PDB: d2bnoa2, d2bnob2
   automatically matched to 1ZZ6 A:6-76
   complexed with hg, so4, zn

Details for d2bnob1

PDB Entry: 2bno, 1.9 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.

PDB Compounds: (B:) epoxidase

SCOP Domain Sequences for d2bnob1:

Sequence; same for both SEQRES and ATOM records:

>d2bnob1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

Timeline for d2bnob1:

• d2bnob1 is new in SCOP 1.73
  
• d2bnob1 appears in SCOP 1.75
  
• d2bnob1 appears in the current release, SCOPe 2.08