Lineage for d2bnoa2 (2bno A:77-198)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810010Family b.82.1.10: TM1459-like [101976] (2 proteins)
  6. 810011Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 810012Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries)
    Uniprot Q56185 77-198
  8. 810015Domain d2bnoa2: 2bno A:77-198 [128844]
    Other proteins in same PDB: d2bnoa1, d2bnob1
    automatically matched to 1ZZ6 A:77-198
    complexed with hg, so4, zn

Details for d2bnoa2

PDB Entry: 2bno (more details), 1.9 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
PDB Compounds: (A:) epoxidase

SCOP Domain Sequences for d2bnoa2:

Sequence, based on SEQRES records: (download)

>d2bnoa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Sequence, based on observed residues (ATOM records): (download)

>d2bnoa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilknvdyyvynclvrtkrapslvplvvdvltdnpddakfnsghag
neflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliavnf

SCOP Domain Coordinates for d2bnoa2:

Click to download the PDB-style file with coordinates for d2bnoa2.
(The format of our PDB-style files is described here.)

Timeline for d2bnoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnoa1