SCOPe 2.07: Domain d2bnnb2: 2bnn B:77-198

Lineage for d2bnnb2 (2bnn B:77-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
   Uniprot Q56185 77-198

8. Domain d2bnnb2: 2bnn B:77-198 [128842]
   Other proteins in same PDB: d2bnna1, d2bnnb1
   automated match to d1zz6a2
   complexed with fcn, zn

Details for d2bnnb2

PDB Entry: 2bnn, 2.5 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin

PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d2bnnb2:

Sequence, based on SEQRES records:

>d2bnnb2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Sequence, based on observed residues (ATOM records):

>d2bnnb2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvyyvynclvrtkrapslvplvvdvltdnpddakfnsghagn
eflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliavnf

Timeline for d2bnnb2:

• d2bnnb2 first appeared in SCOP 1.73
  
• d2bnnb2 appears in SCOPe 2.06
  
• d2bnnb2 appears in the current release, SCOPe 2.08