Lineage for d2bnmb1 (2bnm B:5-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709427Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 2709428Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 2709430Domain d2bnmb1: 2bnm B:5-76 [128837]
    Other proteins in same PDB: d2bnma2, d2bnmb2
    automated match to d1zz6a1
    complexed with so4, zn

Details for d2bnmb1

PDB Entry: 2bnm (more details), 1.7 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d2bnmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnmb1 a.35.1.3 (B:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

SCOPe Domain Coordinates for d2bnmb1:

Click to download the PDB-style file with coordinates for d2bnmb1.
(The format of our PDB-style files is described here.)

Timeline for d2bnmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnmb2