![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
![]() | Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
![]() | Domain d2bnmb1: 2bnm B:5-76 [128837] Other proteins in same PDB: d2bnma2, d2bnmb2 automated match to d1zz6a1 complexed with so4, zn |
PDB Entry: 2bnm (more details), 1.7 Å
SCOPe Domain Sequences for d2bnmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnmb1 a.35.1.3 (B:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg tsigaltppagn
Timeline for d2bnmb1: