SCOP 1.75: Domain d2bnka1: 2bnk A:66-128

Lineage for d2bnka1 (2bnk A:66-128)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.251.1: Phage replication organizer domain [140713] (1 family)
   DNA binding induces further oligomerization

5. Family a.251.1.1: Phage replication organizer domain [140714] (1 protein)
   Pfam PF06720

6. Protein Early protein gp16.7 [140715] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [140716] (3 PDB entries)
   Uniprot P16517 67-130

8. Domain d2bnka1: 2bnk A:66-128 [128833]
   automatically matched to 2C5R A:66-129

Details for d2bnka1

PDB Entry: 2bnk, 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7

PDB Compounds: (A:) early protein gp16.7

SCOP Domain Sequences for d2bnka1:

Sequence; same for both SEQRES and ATOM records:

>d2bnka1 a.251.1.1 (A:66-128) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gsl

Timeline for d2bnka1:

• d2bnka1 first appeared in SCOP 1.73
  
• d2bnka1 is called d2bnka_ in SCOPe 2.01
  
• d2bnka1 appears in the current release, SCOPe 2.08, called d2bnka_