Lineage for d2bnka1 (2bnk A:66-128)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651738Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 651739Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
  5. 651740Family a.251.1.1: Phage replication organizer domain [140714] (1 protein)
    Pfam PF06720
  6. 651741Protein Early protein gp16.7 [140715] (1 species)
  7. 651742Species Bacteriophage phi-29 [TaxId:10756] [140716] (3 PDB entries)
  8. 651743Domain d2bnka1: 2bnk A:66-128 [128833]
    automatically matched to 2C5R A:66-129

Details for d2bnka1

PDB Entry: 2bnk (more details), 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7
PDB Compounds: (A:) early protein gp16.7

SCOP Domain Sequences for d2bnka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnka1 a.251.1.1 (A:66-128) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gsl

SCOP Domain Coordinates for d2bnka1:

Click to download the PDB-style file with coordinates for d2bnka1.
(The format of our PDB-style files is described here.)

Timeline for d2bnka1: