Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
Protein automated matches [190400] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [187271] (3 PDB entries) |
Domain d2bnfb_: 2bnf B: [128827] automated match to d2bnea1 complexed with gol, utp |
PDB Entry: 2bnf (more details), 2.45 Å
SCOPe Domain Sequences for d2bnfb_:
Sequence, based on SEQRES records: (download)
>d2bnfb_ c.73.1.3 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} nakpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrg aglakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeai sllrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatm yeqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
>d2bnfb_ c.73.1.3 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} nakpvykrillklsgealqgtefgidasildrmaqeikelvelgiqvgvvigggnlfrga glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnvcdsyswaeaisl lrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmye qltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite
Timeline for d2bnfb_: