SCOPe 2.06: Domain d2bnfa_: 2bnf A:

Lineage for d2bnfa_ (2bnf A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187271] (3 PDB entries)

8. Domain d2bnfa_: 2bnf A: [128826]
   automated match to d2bnea1
   complexed with gol, utp

Details for d2bnfa_

PDB Entry: 2bnf, 2.45 Å

PDB Description: the structure of e. coli ump kinase in complex with utp

PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d2bnfa_:

Sequence, based on SEQRES records:

>d2bnfa_ c.73.1.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records):

>d2bnfa_ c.73.1.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplnvcdsyswaeaisl
lrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmye
qltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Timeline for d2bnfa_:

• d2bnfa_ first appeared in SCOP 1.73, called d2bnfa1
  
• d2bnfa_ appears in SCOPe 2.05
  
• d2bnfa_ appears in SCOPe 2.07
  
• d2bnfa_ appears in the current release, SCOPe 2.08