SCOPe 2.01: Domain d2bn7a2: 2bn7 A:177-439

Lineage for d2bn7a2 (2bn7 A:177-439)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (26 PDB entries)

8. Domain d2bn7a2: 2bn7 A:177-439 [128821]
   Other proteins in same PDB: d2bn7a1
   automatically matched to d1a16_2
   complexed with flc, leu, mg, mn, pro, zn

Details for d2bn7a2

PDB Entry: 2bn7, 2.4 Å

PDB Description: mn substituted e. coli aminopeptidase p in complex with product and zn

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bn7a2:

Sequence; same for both SEQRES and ATOM records:

>d2bn7a2 d.127.1.1 (A:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

Timeline for d2bn7a2:

• d2bn7a2 first appeared in SCOP 1.73
  
• d2bn7a2 appears in SCOP 1.75
  
• d2bn7a2 appears in SCOPe 2.02
  
• d2bn7a2 appears in the current release, SCOPe 2.08