![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (23 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
![]() | Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry) Uniprot Q7BHK8 2-170 |
![]() | Domain d2bmxc1: 2bmx C:2-170 [128819] automatically matched to 2BMX A:2-170 mutant |
PDB Entry: 2bmx (more details), 2.4 Å
SCOP Domain Sequences for d2bmxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmxc1 c.47.1.10 (C:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqs
Timeline for d2bmxc1: