Lineage for d2bmxc1 (2bmx C:2-170)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834330Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 834343Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)
  7. 834355Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry)
    Uniprot Q7BHK8 2-170
  8. 834358Domain d2bmxc1: 2bmx C:2-170 [128819]
    automatically matched to 2BMX A:2-170
    mutant

Details for d2bmxc1

PDB Entry: 2bmx (more details), 2.4 Å

PDB Description: mycobacterium tuberculosis ahpc
PDB Compounds: (C:) alkyl hydroperoxidase c

SCOP Domain Sequences for d2bmxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmxc1 c.47.1.10 (C:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}
plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc
pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa
agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqs

SCOP Domain Coordinates for d2bmxc1:

Click to download the PDB-style file with coordinates for d2bmxc1.
(The format of our PDB-style files is described here.)

Timeline for d2bmxc1: