SCOP 1.73: Domain d2bmxc1: 2bmx C:2-170

Lineage for d2bmxc1 (2bmx C:2-170)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry)

8. Domain d2bmxc1: 2bmx C:2-170 [128819]
   automatically matched to 2BMX A:2-170
   mutant

Details for d2bmxc1

PDB Entry: 2bmx, 2.4 Å

PDB Description: mycobacterium tuberculosis ahpc

PDB Compounds: (C:) alkyl hydroperoxidase c

SCOP Domain Sequences for d2bmxc1:

Sequence; same for both SEQRES and ATOM records:

>d2bmxc1 c.47.1.10 (C:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}
plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc
pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa
agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqs

Timeline for d2bmxc1:

• d2bmxc1 is new in SCOP 1.73
  
• d2bmxc1 appears in SCOP 1.75
  
• d2bmxc1 appears in the current release, SCOPe 2.08, called d2bmxc_