Lineage for d2bmxa1 (2bmx A:2-170)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877472Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2877475Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry)
    Uniprot Q7BHK8 2-170
  8. 2877476Domain d2bmxa1: 2bmx A:2-170 [128817]

Details for d2bmxa1

PDB Entry: 2bmx (more details), 2.4 Å

PDB Description: mycobacterium tuberculosis ahpc
PDB Compounds: (A:) alkyl hydroperoxidase c

SCOPe Domain Sequences for d2bmxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}
plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc
pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa
agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqs

SCOPe Domain Coordinates for d2bmxa1:

Click to download the PDB-style file with coordinates for d2bmxa1.
(The format of our PDB-style files is described here.)

Timeline for d2bmxa1: